PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00114112001
Common NameGSBRNA2T00114112001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 229aa    MW: 25409.7 Da    PI: 9.8309
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00114112001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA103.42e-32140196158
            CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                          +ep++VNaKQy++Il+RR++Rakle+++kl +ksrkpylheSRh hAl+R RgsgGrF
  GSBRNA2T00114112001 140 NEPIFVNAKQYHAILRRRKHRAKLEAQNKL-IKSRKPYLHESRHLHALKRVRGSGGRF 196
                          59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-36138199IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.957139199IPR001289Nuclear transcription factor Y subunit A
PfamPF020455.2E-27141196IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006164.3E-23142164IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860144164IPR018362CCAAT-binding factor, conserved site
PRINTSPR006164.3E-23173196IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MQVFQRKDSM PTNTNIQGSQ SFSLTKDMMM MSTQSSLQLQ DQDSSSTQSS GESGGGCEVA  60
SFVEHNRYGC SSIVNTNLPD SVFPLPTSDL ASWPPPCPET PHFNGFLAPE YASQPTALSH  120
LEMMGLASSR VPLPHNIQEN EPIFVNAKQY HAILRRRKHR AKLEAQNKLI KSRKPYLHES  180
RHLHALKRVR GSGGRFLNTK KVQDSSNTPF RFSGYPSTHY VSALMLGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-20140200262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.190486e-94seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00114112001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3869571e-120AF386957.1 Arabidopsis thaliana Unknown protein (F15I1.26) mRNA, complete cds.
GenBankAY0814451e-120AY081445.1 Arabidopsis thaliana unknown protein (At1g54160) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013730962.11e-140PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_013730961.11e-140PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_013740368.11e-140PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
RefseqXP_013740364.11e-140PREDICTED: nuclear transcription factor Y subunit A-5-like isoform X1
SwissprotQ9SYH41e-114NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLA0A078EMV71e-171A0A078EMV7_BRANA; BnaA08g00840D protein
STRINGBra030899.1-P1e-137(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM116331733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.11e-100nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]